Prevention and Longevity Catalog 2026 Catalogvalidity:M ay1–October31 Addlifetoyouryears!Startnow!
Live wel up to 100 years! DO NOTAC EPTDECLINEASNORMAL. LONGEVITY isnotan ac ident.Itisa CHOICE! ENERGY MOBILITY CLARITY IMMUNITY PROGRES Sustained energy Freedom and movement A clear mind Celular protection Strategy, notreaction
DearmembersoftheLifeCare® community, “W e don’tjustwantto add yearsto people’slives, butto add life to theiryears.” Twentyyearsago,LifeCare® wasbornfrom asimpleyetprofoundbelief: caring forpeople mustbe authentic,responsible,and builtforthe long term. Today,aftertwodecadesofgrowth,innovation,andtrustearnedstepby step,weareenteringanew stageoftheLifeCare® brand.A rebranding thatdoesnotchangeourfundamentalvalues,butcariesthem forward w ith greaterclarity,m aturity,and vision. W EL 100 isnotjustanew sym bol. Itisourdirectiontowardlongevity,balance,andqualityoflife. Itis the promise thatLife Care® looks beyond the present,building solutionsthatsupporthealth,wel-being,andvitalityoverthelongterm. Forus,W EL 100 m eans: •morelifeineveryday, •consciouschoicesforbodyandmind, •productsandconceptsthatsupportpeopleateverystageoftheirlives. Thisnew LifeCare® chapterisaboutbothinnovationandcontinuity. About hecouragetoevolvewithoutlosingthees enceofwhoweare. W e look ahead with responsibilty,enthusiasm,and gratitude forthe communitythathasgrownalongsideus. Together,we are moving toward a future where longevity becomesa wayoflife. Cristian& DanOnețiu FoundersofLifeCare® #I'm GoodInM yLife #I'm InGoodShape #GoodIsBalanced #I’m GoodInTheM orning #I’m GoodOnTheRoads #I’m GoodAt50Years #I'm FeelingGoodW ithM yself
aNEW LIFESTYLEIN THE LIFECARECOMMUNITY! OVER7MILION unique consumersofourproducts OVER 4MIL ION PACKAGES deliveredtoourcustomers PROFES IONALWORK PROCES ES auditedanddeliveredbyM icrosoft,TÜV Austriaandmanymore OVER30MILION PRODUCTS soldtoourclients METHODOLOGIESAND INTERACTIVESALES TOOLS used byover1,500entrepreneurs CERTIFIED PRODUCTS Ecoinspect,Ecocert,ICEA, Natrueandothers FRE SHIPPING forordersover50euro MANYSOCIALRESPONSIBILITY projectsthatbroughtus thetopcompaniesCSR OVER65MILION EUROS grantedascashbonuses,prom otions,trips, cars,cam paigns,prizesortrainingcourses +200MILION euroturnover A RECOGNIZED AND TRUSTED BRAND, presentinalmajorbusines publications suchasForbes,Capital,M oneyChanneland manymore. LIFE CARE®, EUROPEAN COMMUNITY! W edelivertoalEuropean countries!
Discovertheproductsinthe HEALTH AND IMMUNITY range 3 HEALTHANDIMMUNITY
M adeinGermany 250 ml £ 11.99 M usclecapsules , Devil'sClaw,LifeCare® actsinternaly 4101 £ 11.79 30capsules M adeinGermany 4454 500 ml £ 14.79 Devil’sClaw,CoolingGel,with BIO plants,LifeCare® relaxesm usclesand joints PRODUCTSOLD +3.3MILIONS 4453 4 HEALTHANDIMMUNITY
M adeinGermany W arm ingGel,BearPower,with BIO plants,LifeCare® anƟrheum aƟcef fect 500 ml £ 18.49 250 ml M adeinGermany £ 11.39 4100 4052 30capsules M obiltycapsules , BearPower,LifeCare® increasesm obilty PowerROL byBearPower®, w ith BIO plants,LifeCare® relievesm usclepain £ 12.69 50 ml M adeinGermany £ 12.99 4483 4482 PRODUCTSSOLD +6.5MILIONS 5 HEALTHANDIMMUNITY
FabricatînGerm ania 250 ml £ 8.29 4496 Kom fortRolwith BIO plants,LifeCare® lightfe tfe ling GelAcƟvewith Red Turm eric,LifeCare® £ 13.59 40 ml M adeinitaly M adeinItaly £ 10.49 8% DISCOUNT 60 ml 4459 M agicRol,withBIO plants,LifeCare® reducesm usclepain 4458 6 HEALTHANDIMMUNITY
Hydration & protection M adeinGermany £ 11.29 250 ml 4030 Footcream ,with ureaand BIO plants,LifeCare® to m aintain skin m oisture Footcream ,w ith vineleaves and BIO plants,LifeCare® im provingcirculaƟon 4330 M adeinGermany £ 11.99 250 ml M adeinItaly £ 14.59 100 ml 4108 M agicICEw ith BIO plants, LifeCare® revitalizingand toning 7 HEALTHANDIMMUNITY
M adeinGermany M adeinItaly Oil,„Grandm a'ses ence”, w ith BIO plants,LifeCare® soothesand relaxesthe senses 4624 Grandm other'sBalm , "GoodNight",withBIO plants,LifeCare® wel-beingand resƞulsle p 4406 £ 7.89 15 ml £ 9.99 10 ml 7% M adeinGermany Balm ,“Grandm a'scure”,w ith BIO plants,LifeCare® againstheadaches 4405 £ 8.59 15 ml w ithin the lim it ofavailablestock DISCOUNT 24% DISCOUNT 8 HEALTHANDIMMUNITY
withinthe limit of available stock Bodycream ,withBIO calendula,LifeCare® calm ingef fect 4420 £ 11.79 250 ml M adeinGermany M arigold and Vitam in E Ointm ent,LifeCare® protectsand nourishestheskin 4991 £ 9.19 100 ml M adeinGermany 4460 £ 9.99 50 ml M adeinItaly Insectspray,ProtektSpray, w ith citronelaand BIO plants,LifeCare® ke p insectsatbay 4450 Recoverygel, „Knitbone”,with com freyandBIO plants,LifeCare® posttraum aƟc £ 12.99 250 ml M adeinGermany 9 HEALTHANDIMMUNITY
30 esential oils 100 ml £ 18.99 M adeinItaly Oil,M agicOil,LifeCare® oilfrom over30herbs 4083 concentrated product 4351 4440 £ 10.99 250 ml RegeneraƟngbody cream ,w ith BIO m ountain arnica, LifeCare® skin regeneraƟon M adeinGermany £ 12.59 250 ml BodyCream with Frankincenseand BIO plants,LifeCare® relaxesm uscle contracƟons 4588 M adeinGermany 10 HEALTHANDIMMUNITY M adeinGermany £ 12.99 500 ml M as ageloƟon, w ith BIO plants, LifeCare® relaxingef fect forthebody
Dr.Mariana Ciupa SeniorConsultantinObstetricsandGynecology FounderofFeminenceM edicalCenter,Timișoara–aclinic specializedinwomen’shealthateverystageoflife. Every wom an goes through stages in life m arked by profound transform ationsand horm onalfluctuations,especialyrelated to the three im portant “M’s” in her life: Menstruation, Maternity, and Menopause. These hormonalf luctuations,although a naturalpartofa woman’slife, afectphysical,emotional,and mentalhealth.Therefore,the female bodyneedsconstantsupport,atention,andes entialnutrients. In a world where wom en balance career,fam ily,and self-care, maintainingbalancebecomesapriority. Formanywomen,thedaysbeforemenstruationareac ompanied by fatigue, iritabilty, water retention, or m uscle discom fort. These symptoms can inf luence both profes ionaland personal life. Certain dietary supplements can be very helpfulduring this period,andVitexagnus-castusisaplantextractrecognizedforits roleinsupportinghormonalbalance. The period after childbirth is also one of the most intense experiencesin awoman’slife.Alongsidethejoyofmotherhood, physicaland em otionalchalengesm ayarise:signif icantfatigue, hormonalchanges,andtheneedforrecovery. During this stage as wel,the rightvitamins and minerals can supportthe body in its naturalrecovery proces .Forexample, rosehip extract contributes to m aintaining joint health— an im portant aspect for always-active m others— w hile es ential nutrientssupportdailyenergylevelsandvitality. Then comes menopause, which marks a new chapter in a woman’s life. Although it is a natural proces , it can be ac ompanied byhotf lashes,sleep disturbances,mood changes, orjointdiscomfort. Supporting the body through an appropriate intake ofdietary supplementsbecomesveryimportantduring thisperiod.One of these is Vitex agnus-castus,known forits benef icialefects in helping relieve menopause-related symptoms and maintaining overal physical and m ental wel-being. Calcium and natural extracts complete the formula,providing supportforthe body duringthisadaptationphase. Itisimportanttorememberthateverybodyhasdiferentneeds, and the requirementforsupplements,the corectdosages,and the periods of use should be determined only on the recommendationofaphysician. Hormonalbalance and reproductive health play a key role in a woman’soveralwel-being.Inthecontextofmodernlifestyles, stres ,m etabolicim balances,and dietary habitscan negatively inf luence ovarian function and the regularity ofthe menstrual cycle. An increasing numberofpatients are experiencing hormonal im balances, ovulatory disorders, polycystic ovary syndrom e (PCOS),ordiff icultiesinachievingpregnancy. In thiscontext,wel-formulated and properly dosed nutritional supplements can represent valuable support, alongside appropriatem edicalevaluationandm onitoring. The com bination ofMyo-Inositol,D-Chiro-Inositol,Folate,and Coenzyme Q10 is one ofthe moststudied and widely used formulas forsupporting women’s reproductive and metabolic health. Inositolsare naturalcompoundsinvolved in the transmis ion of hormonalandmetabolicsignalsatthecelularlevel.A balanced ratio between Myo-Inositoland D-Chiro-Inositolises entialfor m aintaining norm al ovarian function and is particularly benef icialforpatientswithpolycysticovarysyndrom e. Upon a physician’srecommendation,folate supplementation is advised foral women during the preconception period and in the f irst trimester of pregnancy, contributing to the normal developmentofthefetalnervoussystem. Coenzym eQ10isanaturalantioxidantinvolvedinm itochondrial energyproduction.Inwomenwhowishtoconceive,CoQ10may helpoptimizethecelularenvironmentneces aryforembryonic development. The combination ofMyo-Inositol+ D-Chiro-Inositol+ Folate + Coenzyme Q10 represents valuable support in maintaining horm onalbalance,supporting fertilty,and optim izing celular metabolism. W hen used corectly,as partofan individualized therapeutic plan and under medical supervision, this supplement can contribute to improving quality oflife and supporting women’s reproductivehealth. 11 HEALTHANDIMMUNITY
LiquidFoodSupplem ent from NoniJuice, VitalyaW om an,LifeCare® 824 M adeinItaly 500 ml £ 16.99 Fem oPlus,dailysupportfor thefem alebody,LifeCare® 7423 M adeinGermany 60capsules Availablefrom June £ 23.99 M anXDrive,support form ale vitality and perform ance, LifeCare® NEW! NEW! 26% DISCOUNT 21% DISCOUNT 25% DISCOUNT 7422 M adeinGermany 30capsules £ 14.99 12 HEALTHANDIMMUNITY
EnergyM aca,w ith Aschwagandhaand Om ega3,LifeCare® itim provesyourm ood Lady’sDesire,LifeCare® sexualtonicforwom en 7083 740 £ 16.79 30capsules M adeinGermany M adeinFrance w ithin the lim its ofavailablestock £ 13.49 30capsules CysƟGuard,w ith D-M annoseforurinary tracthealth,LifeCare® ef fecƟveprotecƟon forurinarytracthealth 7417 M adeinItaly £ 13.19 23% DISCOUNT 7sachets(56g) 30capsules £ 15.89 M adeinGermany ProstaNEW ,with pine phytosterolsandpum pkin seeds,LifeCare® m aintainstheurinary tracthealth 7048 13 HEALTHANDIMMUNITY
30capsules M adeinGermany M adeinGermany M egaCom plex,vitam ins and es enƟalm inerals, LifeCare® advanced nutrientform ula 7310 1513 B M agnif icent,vitam in com plexB1,B2,B3, B5,B6,B12,LifeCare® com plexofVitam inB £ 17.99 £ 10.59 30capsules M enopause,with Eveningprim rose powder,LifeCare® reducesm enopause symptoms 7420 M adeinGermany £ 10.19 30capsules M adeinGermany £ 10.29 30capsules M enstroEasy,w ith night lightoilsand vitam in E, LifeCare® relievesprem enstrual symptoms 1511 14 HEALTHANDIMMUNITY
FerVit,w ith BIO acerola, LifeCare® im portantsourceofiron 1597 £ 9.69 30capsules M adeinGermany NaturalVitam in E400IU,LifeCare® celprotecƟon 7110 £ 17.99 30capsules M adeinItaly M adeinGermany £ 9.79 30capsules M agicE,w ith m agnesium and vitam in E,LifeCare® com plexofM agnesium andVitam inE 1581 M adeinGermany £ 10.89 30capsules M agneBeHappy,with m agnesium and vitam in B6,LifeCare® f ighƟngof f stres 1506 15 HEALTHANDIMMUNITY
10monodose/100ml M adeinItaly 851 FoodSupplem ent,Super EnergyShot,with Coenzym e Q10and L-CarniƟne,LifeCare® £ 14.29 L-TyrosineCom plex,LifeCare® opƟm alsupportofthethyroid gland 7105 £ 18.59 7% DISCOUNT 16% DISCOUNT 30capsules M adeinGermany M adeinGermany £ 11.39 30tablets OrganicPure M oringa,LifeCare® generaltonic 7036 16 HEALTHANDIMMUNITY
14% DISCOUNT 7008 M agicSuperFood,37es enƟal nutrients,LifeCare® energyand vitam inizaƟon M adeinGermany 30tablets £ 10.49 M adeinGermany £ 33.49 500 ml 100% BIO Noni Juice M adeinItaly £ 22.69 500 ml Liquid dietarysupplem entwith Goji, blackcheries,and Vitam in C,LifeCare® physicaland m entalrevitalizer 822 OrganicNoniJuiceLiquidFood Supplem ent,PureNoni,LifeCare® energyand vitality 8118 17 HEALTHANDIMMUNITY
Dr.AdelaGorun SeniorConsultant Balneologyand MedicalRehabiltation Colagen is an important component of the musculoskeletal system, and additional intake through the product“Colagen Boosterwith Vitamin D3 and BIO Rosehip,Life Care®”isrecommendedfor improvingjointfunction. Physical activity, in any form, is absolutely necesary. Whether you practice a sport,folow a specialized physiotherapyprogram,orsimplyavoid a sedentary lifestyle by cycling or walking, muscle contraction on the bonepreventscalcium los from bones, “lubricates” the joints, and increases musclestrengthandendurance. Exces ive joint strain can lead to inf lammationac ompaniedbypain,and age-related rheumatism may som etim escause pain thatissensitive toweatherchanges. Theantirheum aticgel“Bear Power,w ithBIO plants,LifeCare®” contains12activeplant-based ingredientsthatefectivelyhelp soothejointandmusclepain, providingthecomfortneededfor an active life. Balanced nutrition,adapted to each individual,aim sto m aintain an idealbodyweightsothatweight-bearingjointsarenotoverloaded. Itisalso importantto compensate fordef icienciesin mineralsand vitaminses entialforthe properfunctioningofthe musculoskeletal system ,suchascalcium ,m agnesium ,vitam inD,etc. W hen speaking aboutjoints,afteraround the age of40, the balance gradualy shifts toward wear and degeneration, a natural proces that may sometimes evolve into osteoarthritis.Jointstifnes — the rigidity we oftenfeelinthemorninguponwaking-tendstoincrease, while joint mobilty decreases, causing pain and discomfortduringmovement. Bonedemineralization,known amongmenopausalwomenas osteoporosis,canac eleratethe progres ionofosteoarthritisand representsa riskfactorforfractures. Musclesgradualylosetheir resistance to efort,m uscle strength decreases,andsometimesmuscle tonediminishes,withmuscletis ue partialyreplacedbyadiposetis ue. Asaresult,wem aynoticediff iculties indailyactivitiesthatweonce performedeasilyorwhenpracticing sports. Throughoutlife,ourbodyisin aconstantbalancebetween destructionandregeneration. PREVENTION!! AT ENTION!! 18 HEALTHANDIMMUNITY
M adeinItaly £ 26.99 500 ml Liquidfoodsupplem ent forhair,nails,and joints, Colagen Booster,with vitam in D3and organic rosehip,LifeCare® Happy&RelaxM uscle,with potas ium ,m agnesium and vitam in B6,LifeCare® reducesm usclecram ps 7007 M adeinGermany M adeinGermany £ 10.49 30capsules 4055 4483 MadeinUE CannabiCalm body buƩer,withCBD 1000m g,LifeCare® relaxesm uscles £ 21.49 100 ml W arm ingGel,Bear Power,withBIO plants,LifeCare® anƟrheum aƟcef fect 250 ml £ 12.99 7089 19 HEALTHANDIMMUNITY
7339 774 Calcium and M agnesium CoralCom plex,LifeCare® m aintainstheskeletal system £ 10.99 30capsules M adeinGermany M adeinItaly £ 20.39 60 ml M agnesium OilSpray, M agneAcƟve,LifeCare® fastabsorbing £ 21.49 500 ml M adeinItaly Liquidfoodsupplem entforjoints, CoralCalcium ,com plexofm inerals and traceelem ents,LifeCare® 8850 19% DISCOUNT 20 HEALTHANDIMMUNITY
7037 M SM Power,LifeCare® m aintainsjointhealth £ 10.99 30capsules M adeinGermany 7044 M adeinGermany £ 15.49 30capsules Com plexwithvitam inD3 (2000IU),K2and Om ega 3 f lax,Life Care® m aintainsbonehealth £ 30.49 500 ml M adeinSpain Liquidfoodsupplem entforjoints,Joint Elixir,SynergisƟcAcƟon with ChondroiƟn, Glucosam ineand M SM ,LifeCare® supportsjointm obilty 8800 21 HEALTHANDIMMUNITY
11% DISCOUNT 766 7107 M adeinGermany £ 14.49 30capsules AcƟveSalicin,w ith w hitew ilow barkextract,LifeCare® naturalsource ofsalicin £ 14.49 30capsules M adeinGermany £ 19.99 30capsules M adeinGermany JointPower,Hydrolyzed m arinecolagen,LifeCare® M uscleand JointRecovery ArtroLife,w ith green shelextract,LifeCare® forjointelasƟcity 7042 22 HEALTHANDIMMUNITY
As oc.Prof.Dr.LaviniaM .Bratu VictorBabeșUniversityofMedicineandPharmacy, Timișoara–DepartmentofNeurosciences Biologist,Nutrition Counselor ClinicalPsychologist Founderof“Dietetica–anew philosophyoflife” Longevityis,es entialy,a proces ofharm onization, ratherthan an efortoran obses ive pursuit. Inthiscontext,nutritiontakesonamuchde permeaningthansimplyservingasfuel.W hatweeat isinformationforeverycelinthebodyandinf ul encesinf al mmation,immunity,hormonalbalance, brain function,andourdailyenergylevels.A clean,simpledietadaptedtothebody’srealne ds sup ortsmentalclarity,stabilzesblo dsugar,reducesinf al mmatoryload,andgivesthebodythe chance to repairand regenerate.The key isnotperfection butgentle consistency those go d choicesrepeateddayafterday. Atthesametime,qualitysup lementscanplayavaluableroleintheequationoflongevitywhen viewed corectly:asinteligentformsofsup ort,notmiraculoussolutions.Theycan help corect realdef ci iencies,sup ortthe body during periods ofstres orexhaustion,as istregenerative proces es,andprovideprotectionwheremodernlifestylesconsumeourresourcesfasterthanwe canrestorethem .However,nosup lem entcanreplacesle p,elim inatechronicstres ,repairtoxic relationships,orcompensatefordisconnectionfrom oneself.Longevityisbuiltdaybyday;itisnot servedinadoseorapil. Thereare,however,es ential“nutrients”forlongevitythatcannotbefoundon labels: safe and supportive relationships, a sense of belonging, personal meaning,thejoyexperienceddaily,eveninsmalforms. Theseregulatethestres axis,protectthebrain,supportim m unity,andkeepthe desire forlife alive.W ithoutthem,anyprotocolremainsincomplete,no mater how sophisticateditmaybe. Forme,theconclusionisbothsimpleandprofound:longevityisanaliancewith lifeandwithdailychoices:withthewayyoueat,withthewayyousupportyour body through supplements,with the relationshipsyou cultivate,with the way youinvestyourtime,care,andsenseofpurpose. W hen althese worktogether,the yearsare notonlymore numeroustheyare m orealive,fuler,andtrulyyours. To seek the rhythm of life and folow it this is longevity. Sometimes,smalchangesinthewayyoulivedaybydayhelp you realize something es ential:you are the source ofyour own energy,and your activities and relationships exist to supportandactivatethevitalenergyyoualreadypos es . AtLife Care®,longevity isnota promise buta commitmenta commitmentto quality,balance,and choicesthatsupportlife inthelongterm.Becausetruelongevityislived,notrushed. • w ith life itself; • withthebody,whichyounourishproperly; • withthemind,whichyoucometounderstandandrespect; • withdailychoices,includingthoserelatedtonutrition,supplements,feelings,people,and relationships. W hen al these elementsworktogether,ouryears becomefulerandtimebecomesrelative. W eliveinaperiodinwhichlongevityhasbecomea central concern. There is increasing discus ion aboutadding more yearsto life,aboutanti-aging formulas, supplements, protocols, tests, and sophisticatedstrategiesforextendinglife.Andyet, from my perspective, the es ential question remainsdiferent:nothow long we live,buthow we live each ofthe years we have.Because the diferencebetweenaddingyearstolifeandadding lifetoyearsisprofound. True longevity begins within in the way we live, feel,think,andrelatetoourselvesandtotheworld. Asapsychologist,Ihavewitnes edcountles times how the body folowsthe mind sometimessubtly, sometimesdramaticaly.Chronic stres ,prolonged emotionaltension,lack ofmeaning,insecure or conf lictualrelationships do not only exhaust us; they also consume ourvitalresourcesand age us prem aturely. And so,we realize thatdiff iculteventsthem selves arenottherealproblem,butratherthecontinuous state ofalertnes in which we remain trapped for years.Onlywhen • weconsciouslystepoutofsurvivalmode, alow ourselves to regulate emotionaly and respectourownrhythm andlimits,and • reconnectwithwhat rulymaters,doesthebody receive the proper environment needed to functionhealthilyinthelongterm. Form e,longevityisa form ofaliance,farfrom being a race againsttim e ora fightwith the inevitable.Longevityisa quiet and constantaliance: 23 HEALTHANDIMMUNITY
Glow Ritual- BEAUTYGLOW, LifeCare® 1404 £ 30.49 M adeinGermany 150 g DailyCleanse- DETOX & DIGEST, LifeCare® 1405 £ 30.49 M adeinGermany 150 g FocusFuel- ENERGY& FOCUS, LifeCare® 1406 £ 30.49 M adeinGermany 150 g Shield Up - IMMUNO GUARD, LifeCare® 1407 £ 26.99 27% DISCOUNT 27% DISCOUNT 20% DISCOUNT 22% DISCOUNT M adeinGermany 150 g 24 HEALTHANDIMMUNITY
NEW! M adeinGermany £ 8.49 26% DISCOUNT 29% DISCOUNT 29% DISCOUNT 25% DISCOUNT 30capsules Availablefrom July Availablefrom July Availablefrom July Availablefrom August 7643 CreaƟneM onohydrate, 300m g,LifeCare® Perform anceand Endurance M adeinGermany £ 10.49 30tablets 7644 M agnesium Bisglycinate, 1200m g,LifeCare® High Bioavailabilty M adeinGermany £ 13.49 30tablets 7642 Liposom ales Vitam in C,1000m g, LifeCare® M adeinGermany £ 13.49 30capsules 7645 AshwagandhiKSM -66, 350m g,LifeCare® 25 HEALTHANDIMMUNITY
OrganicSpirulina, LifeCare® regulatesbodyfuncƟons 7013 7113 ResveratrolPlus,LifeCare® thesecretofyouth 7490 GalangalRootExtract, 400m g,LifeCare® es enƟalnutrients 7109 £ 10.39 45tablets M adeinGermany ForƟHair&Nails,w ith bioƟn,zinc,selenium and vitam in C,LifeCare® 60gummies £ 24.29 M adeinFrance £ 11.29 20% DISCOUNT 24% DISCOUNT 30capsules M adeinGermany £ 21.99 30capsules M adeinGermany 26 HEALTHANDIMMUNITY
200 ml £ 23.49 22% DISCOUNT 6% DISCOUNT 11% DISCOUNT M adeinItaly Liquidfoodsupplem entfor vision,Sure Sight,w ith Vitam in A,LifeCare® supportseyehealth 8500 BeautyForte,with hyaluronicacid,LifeCare® hairandnailsupplem ent 7039 £ 14.99 30capsules M adeinGermany Lutein w ith Vitam in B Com plex,B-Power, LifeCare® supportsvisionand nervoussystem 7330 £ 22.99 30capsules M adeinGermany Vitam in A 5000IU, LifeCare® supportshealthy eyesight,skin and bodyim m unity 7103 30capsules £ 11.29 M adeinGermany 27 HEALTHANDIMMUNITY
ExpectoVital, LifeCare® 858 £ 12.49 24% DISCOUNT 24% DISCOUNT £ 22.99 200 ml M adeinItaly M adeinGermany £ 18.99 250 ml BIO syrup with fennel and thym e,LifeCare® f ightsof f drycough 431 M adeinFrance 60gummyes Im m unXforte+,w ith vitam ins, zincand selenium ,LifeCare® 7112 M ulƟPlusVit, w ith vitam insand m inerals,LifeCare® m ulƟvitam ins and m inerals 7610 M adeinGermany £ 16.29 30capsules DE-ÖKO-001 28 HEALTHANDIMMUNITY
7085 LarynxForte,throatspray, w ith BIO m arigolds,LifeCare® protectsthethroat and oralcavity Liquidsupplem entwithVitam inC andCalcium ,fortheim m une system ,Life Care® supportsim m unity 8600 M adeinItaly £ 23.59 200 ml M adeinEU £ 7.19 30g(20x1.5g) Organicteaforcoughand expectoraƟon,LifeCare® expectorantand anƟtus ive 570 M adeinGermany £ 11.39 30tablets Vitam inC, 1000mg, LifeCare® prolonged release 764 M adeinItaly £ 12.99 20 ml 29 HEALTHANDIMMUNITY
RO-ECO-008 M adeinEU £ 6.69 30g(20X1.5g) M adeinEU £ 7.49 36g(20x1.8g) M adeinEU Organicherbaland fruit tea,forchildren,LifeCare® supportstheim m unesystem 574 £ 5.79 30g(20x1.5g) M ulƟPlusVitKIDS,with vitam insand calcium forchildren,LifeCare® com plexform ulathatis es enƟalfordevelopm ent 7620 £ 14.49 30beartablets M adeinGermany Organicteaw ith ginger and oranges,forenergy, LifeCare® food supplem ent-energizes and vitalizesthebody 567 Organicherbal and fruittea,for im m unity,LifeCare® supportstheim m une system 573 30 HEALTHANDIMMUNITY
UlƟm ateIm m uno,with BIO acerola and w ilow,LifeCare® supportstheim m unesystem 7040 £ 11.69 30capsules M adeinGermany 200 ml £ 21.99 8700 Vitam inD3,dropsfor children,400IU,LifeCare® m aintainsbonehealth Liquidfoodsupplem entfor children,M ulƟvitam ins,w ith vitam insand m inerals,LifeCare® balanced growth form ula 7080 10% DISCOUNT EchinaPluswith echinacea,propolis and vitam in C, LifeCare® supportsthe im m unesystem 856 £ 10.79 10sachets/50g M adeinGermany M adeinGermany M adeinItaly £ 12.69 25 ml 31 HEALTHANDIMMUNITY
Propolis,LifeCare® strengthensim m unity M adeinGermany £ 12.99 30capsules 737 Over 5 billion beneficial bacteria M adeinGermany £ 18.99 30capsules Colostrum ,400m g, LifeCare® anƟbodiesforim m unity 70700 ProbioLife,w ith germ com plex,LifeCare® probioƟcsforintesƟnalf lora 8042 QuerceƟnPlus Vitam in C,LifeCare® im provestheim m une system 7072 M adeinGermany £ 16.39 30capsules M adeinGermany £ 17.49 30capsules 32 HEALTHANDIMMUNITY
30capsules £ 12.69 M adeinGermany Diab Form ,w ith m om ordicaandalpha lipoicacid,LifeCare® suitableforpersons with diabetes 7530 £ 18.99 70 g OrganicM atcha, LifeCare® anƟoxidant 7100 M adeinGermany £ 8.29 30tablets M adeinGermany M adeinGermany £ 14.49 30capsules ReishiM ushroom Extract, 400m g,LifeCare® strengthenstheim m une system 7081 Zinc,Life Care® acƟvatesthecelular funcƟons 7074 33 HEALTHANDIMMUNITY
M adeinGermany £ 11.79 30capsules RenaloCom plex, with pum pkin seeds, LifeCare® supportstheurinary system 765 30capsules £ 15.49 M adeinGermany UroBlockCom plex, withD-m annoseand cranberies,LifeCare® opƟm alfuncƟoningof the urinarysystem 7052 34 HEALTHANDIMMUNITY
CURCUMIN + PIPERINE = ENHANCED EFFECT! COMPLEX FORMULA 20capsules £ 15.49 M adeinGermany Turm eriCool,with piperine and curcum in,LifeCare® rem ovestoxinsfrom thebody 7012 OrganicAnƟoxidant Graviola,HorseChestnut and AppleM ix,LifeCare® m aintainscelularhealth M adeinGermany £ 31.49 500 ml 7010 DE-ÖKO-007 35 HEALTHANDIMMUNITY
AndaPescariu,MD SeniorConsultantinCardiology SeniorConsultantinInternalM edicine Ifyou have notyetbeen diagnosed with aheartcondition,now isthe besttim e to take care ofyourheart: •Stayphysicalyactiveeveryday,evenshortwalkshelp. •Sleep7–8hourspernight. • M anage stres through breaks from your daily activities, mindfulnes , deep breathing,orspendingtimewithfamily. •Reducesaltintakeandavoidlate,high-fatm eals. •Haveanannualmedicalcheck-up,evenifyoufeelwel. •Pay atention to the foods you and yourfamily consume daily.Avoid proces ed productsasmuch aspos ible and ensure a properintake ofvitaminsand minerals. Unfortunately,modernagricultureoftenleadstoreducedmineralcontentinfood. Prevention thatbeginsbetween 25 and 40 yearsofage can m ake a significant diference at60–70 yearsofage. Ifyou have hypertension,coronary artery disease,arhythm ias,have suferedaheartatack,orhaveanyotherheartcondition: •Takeyourm edicationexactlyasprescribed.Donotstopyourtreatm ent withoutyourdoctor’sapproval.Lookforaphysicianwhocommunicates clearly and provides explanations you can easily understand.Before yourconsultation,preparealistofthequestionsyouwouldlikeclarif ied. •Measureyourbloodpres ureandpulseregularlyandrecordthevalues. • Atend regular medicalcheck-ups,even if you feelwel.Ac es healthcareservicesintim e. Smaldailychangescanhaveamajorlong-term impact. Almostevery second,in a specialplace within ourheart,a remarkable electricalimpulse is generated.This electricalenergy is transformed into mechanicalenergy and,through its pumpingfunction,itbringslifetoourarteries.Theheartbeatsabout100,000timesadayand pumpsbloodthatcariesoxygenandnutrientstoalorgans. W hentheheartfunctionswel,wehaveenergy,wecanconcentratemoreeasily,andweenjoy lifemore.W henproblemsoc ur,seriousconditionsmaydevelop,suchasmyocardialinfarction (heartatack),arhythm ias— w hetherextrasystolesoratrialf ibrilation— up to the m ostfeared condition,heartfailure. Ac ording to the W orld Health Organization,cardiovasculardiseasesare the leading cause of death worldwide.The good newsisthatmany ofthese problemscan be prevented orkept undercontrolthroughsimpledailychoices.Mostdiseasesdonotappearsuddenlyinourlives. W ebringthem upon ourselvesdaybydaythrough ourlifestyle— through thewayweeatand thewaywelive:sedentaryandsometimesperhapsunhappyorunfulf iled. M ostriskfactorscan beinf luencedthrough lifestyle,which means we can manage them through knowledge, determination,andconsciousdecisions. • Quitsmoking –smoking directly damagesblood ves els andincreasestheriskofheartatack. Balanced nutrition – more vegetables,fruits,f ish,and whole grains;fewerproces ed foods,fried foods,sugar, and salt. • Regularphysicalactivity–atleast30m inutesofexercise, atleast5daysperweek. • W eightcontrol–evena5–10% reductioninbodyweight can signif icantlyreduce risks. Monitoringbloodpres ure,bloodsugar,andcholesterol– annualtestscandetectproblem searly. Prevention doesnotmean radicalchangesovernight,but smalandconsistentsteps. Theheartisthe“engine”ofourbody. Recommendationsforhealthyindividuals Practicalguidanceforthosealreadydiagnosed W hetheryou are 25 or70 yearsold,whether you are perfectly healthy oralready have a diagnosis,your heartneeds daily care and atention.Itisnotaboutperfection,butabout consistency.Every step,every m ore balanced m eal,everywalkm aters. You have m ore control over your health thanyoum ightthink.Starttoday-form ore energy,m ore tim e with your loved ones, and a life lived with a strong and healthy heart. A mes ageforyou Cardiovasculardiseaseprevention –whatcanwedoinpractice? 36 HEALTHANDIMMUNITY
£ 42.69 M adeinGermany 60capsules AntarcƟcKrilOil,500m g, LifeCare® Om ega-3(EPA andDHA) 7108 15% DISCOUNT 743 AnƟoxidant,w ith vitam ins and coenzym eQ10,LifeCare® forhealth heart £ 11.99 30capsules M adeinGermany 7051 30capsules Alphalipoicacid com plex, with bioƟn,LifeCare® strengthensblood ves els M adeinGermany £ 14.99 37 HEALTHANDIMMUNITY
853 M adeinItaly £ 26.49 500 ml AnƟoxidantliquiddietary supplem entwithAcaiand blackcheries,LifeCare® supportscardiovascular health 16% DISCOUNT 30% DISCOUNT M adeinItaly 24tablets £ 15.99 VenoxalAcƟve,with Diosm in and Hesperidin,LifeCare® 7418 M adeinGermany £ 10.99 30capsules Omega3with f ish oil,Life Care® cardiovascular protecƟon 747 38 HEALTHANDIMMUNITY
M adeinGermany £ 9.69 30capsules M adeinGermany 30capsules NaƩokinaseenzym e, 2.000FU,LifeCare® healthyvascularsystem 7320 £ 19.99 15% DISCOUNT Garlicand Parsley,LifeCare® lowersbloodpres ureand cholesterol 7600 £ 8.99 30capsules M adeinGermany Ginkgo Biloba,w ith lecithin,LifeCare® im provescirculaƟon 756 39 HEALTHANDIMMUNITY
Sunf lowerlecithin, soŌgelcapsules ,LifeCare® im provescogniƟvefuncƟon 7414 £ 15.89 60capsules M adeinGermany NeuroBoosterCom plex,with Brahm iextractand L-Tryptophan,LifeCare® im provesm em oryandfocus 7046 £ 17.99 30capsules M adeinGermany Cod liveroil,with Om ega3, vitam insA and D,LifeCare® supportsbrain health 7641 30capsules M adeinGermany £ 16.19 22% DISCOUNT 40 HEALTHANDIMMUNITY
NeurotroFIX w ith ciƟcoline, LifeCare® supportsbrainandnervous system health M adeinGermany 30capsules £ 24.99 7102 LifeIm pulse®NADH PLUS-20m g physicaland m entalenergizer 7049 Vitam in B12 M ethylcobalam in 1000m cg,LifeCare® supportsenergy,m etabolism and nervoussystem funcƟon 7104 M adeinGermany 30tablets £ 43.59 M adeinGermany 30tablets £ 10.89 41 HEALTHANDIMMUNITY 9% DISCOUNT
M adeinGermany £ 12.29 60capsules Glycine,400m g,forrelaxaƟon and bodybalance,LifeCare® prom otesrelaxaƟon and reducesstres 7096 M adeinGermany £ 10.49 30capsules Relaxer,w ith Valerian extract,Life Care® relaxing 730 20% DISCOUNT RhodiolaRosea,LifeCare® adaptogen 729 £ 12.99 30capsules M adeinGermany 42 HEALTHANDIMMUNITY
22% DISCOUNT Schisandra,Energizing, LifeCare® generaltonic 7580 £ 9.49 30capsules M adeinGermany M adeinFrance £ 18.29 60gummies SleepEase,w ith m elatonin and blackcurants, LifeCare® 7111 AnƟ-stres ,with Nonifruit,LifeCare® anƟstres M adeinGermany £ 15.49 30capsules HappyDream s,w ith Schisandra,Noni,Rhodiola and Valeriana,LifeCare® stopinsom nia 7041 757 £ 10.29 30capsules M adeinGermany 43 HEALTHANDIMMUNITY
OrganicTeawith Lem on Balm , forrelaxaƟon,LifeCare® soothesand reducesstres 589 £ 7.19 40g(20x2g) M adeinEU £ 12.49 30capsules M adeinGermany M adeinGermany £ 12.49 30capsules NoAlergo,w ith black cum in oil,LifeCare® reducesalergicreacƟons 763 SharkLiverOil,w ith sharkliveroil,LifeCare® im m unosƟm ulant 7550 44 HEALTHANDIMMUNITY
MadeinRomania £ 12.19 SuperW ater® Glas jug1200m l 1127 M adeinGermany £ 34.99 50 ml Com plexofm ineralsandtrace elem ents,LifeCare® dailyintakeofm inerals and traceelem ents 1128 45 HEALTHANDIMMUNITY
Discovertheproductsinthe WEIGHTLOS AND DETOXIFICATION 46 W EIGHTLOS AND DETOXIFICATION
OrganicAloeVeraJuice w ith organiccranbery f lavor,Life Care® digesƟonandim m unity ALLERGENS, FLAVORINGS, SWEETENERS, COLORANTS DOES NOT CONTAIN 8410 OrganicAloeVeraJuice w ith pulp,LifeCare® detoxifyingand im m unoprotecƟve 8004 1000 ml M adeinItaly M adeinItaly 21% DISCOUNT 5% DISCOUNT NEW! 21% DISCOUNT IT-BIO-008 1000 ml £ 33.29 £ 31.49 OrganicAloeVera andAshwagandha Juice,LifeCare® 826 1000 ml M adeinSpain £ 22.99 47 W EIGHTLOS AND DETOXIFICATION
AcaiHealthyM ix,w ith BIO acaiand ginger,LifeCare® liverprotector 7340 M adeinGermany 30capsules £ 9.99 DE-ÖKO-007 M adeinGermany £ 9.49 60tablets 7460 OrganicChlorela, LifeCare® es enƟalnutrients £ 11.79 30capsules M adeinGermany SuperColonCleanse, w ith BIO Psylium husk,LifeCare® intesƟnaldetoxif ier 745 7075 48 W EIGHTLOS AND DETOXIFICATION
M adeinGermany £ 11.99 30capsules Sm okersAid Detox, witharcƟum root and arƟchoke,LifeCare® detoxwitharƟchoke 7460 M adeinGermany £ 10.79 30capsules BarleyGras ,w ith BIO barley,LifeCare® cholesterolcontrol 7440 £ 6.69 30g(20x1.5g) M adeinEU OrganicChinesegreen tea, fordetoxif icaƟon,LifeCare® naturalenergizer £ 7.19 30g(20x1.5g) M adeinEU Organicherbaland fruittea, foreasytransit,LifeCare® helpsguttransit 576 RO -ECO -0 8 RO -ECO -0 8 575 49 W EIGHTLOS AND DETOXIFICATION
15% DISCOUNT 28% DISCOUNT RO-ECO-0 8 M adeinGermany £ 8.99 30capsules M adeinGermany £ 8.59 30tablets Pineapplefor digesƟon,LifeCare® digesƟveadjuvant 738 30tablets £ 12.29 M adeinItaly SennaandBuckthorn Com plex,forEasyTransit, LifeCare® supportsintesƟnalf lora balance 7411 M adeinGermany £ 13.59 30capsules NO.1DigesƟve Enzym e,w ith brom elain and papain,LifeCare® supportsthedigesƟve system 7047 OrganicGingerRoot, 500m g,LifeCare® supportsdigesƟvehealth 7106 50 W EIGHTLOS AND DETOXIFICATION
ARTICHOKE EXTRACT 5:1 400 MG 6% DISCOUNT Product with new packaging 7415 30tablets £ 16.49 M adeinItaly Ref luxGuard,Stom ach Com plex,LifeCare® reducesacid ref lux 30capsules £ 16.29 M adeinGermany UlƟm ateLiverSupport,w ith arƟchokeleaves,LifeCare® liverprotector 759 30capsules £ 11.49 M adeinGermany Sanobil,w ith arƟchoke,LifeCare® arƟchokeforbilary protecƟon 7015 51 W EIGHTLOS AND DETOXIFICATION
30capsules £ 11.79 M adeinGermany L-CarniƟne,LifeCare® ac eleratesfatburning 7045 20tablets £ 11.69 M adeinItaly GastroBalm ,w ith baking soda,m arshm alow,and cham om ile forgastric balance,LifeCare® supportsdigesƟvehealth and gastricbalance 7416 30 ml £ 11.69 M adeinItaly IntesƟClean,dropswith grapefruitseeds,for intesƟnalbalance,LifeCare® supportshealthydigesƟon andgutf lorabalance 859 M adeinItaly 500 ml £ 19.29 24% DISCOUNT 21% DISCOUNT 21% DISCOUNT Liquidfoodsupplem ent fordigesƟon,DigesƟon⁺, w ith papaya,fennel and aloevera,LifeCare® 823 52 W EIGHTLOS AND DETOXIFICATION
M adeinGermany £ 14.99 30capsules Slim M eforweightlos , with BIO green tea extract,Life Care® suppres esfatstorage 7016 M adeinGermany £ 11.29 30capsules Chitosan,regulates cholesteroland helps controlw eight,LifeCare® preventsfatabsorpƟon M adeinGermany £ 14.49 30capsules Glucom annan Extract,Life Care® reducesappeƟte 7056 754 53 W EIGHTLOS AND DETOXIFICATION
M adeinGermany £ 24.99 30capsules Berberinewith Fenugreek, Com plexforIdealW eight, LifeCare® ac eleratestheslim m ingproces 70001 15% DISCOUNT 788 300 g £ 31.79 M adeinGermany 300 g £ 31.79 M adeinGermany Form Shakevanila f lavour,Life Care® nutriƟonalcom plex Form Shakechocolate f lavour,Life Care® nutriƟonalcom plex 789 54 W EIGHTLOS AND DETOXIFICATION
Discovertheproductsinthe BEAUTYAND PERSONALCARE range 55 BEAUTYANDPERSONALCARE
56 BEAUTYANDPERSONALCARE Dr.Teodora Hoinoiu SeniorConsultantinPlastic,Aestheticand Reconstructive M icrosurgery Casa Austria,Tim ișoara As ociate Profes or,ClinicalSkils University Clinic VictorBabeșUniversityofMedicineand Pharm acy,Tim ișoara In thiscontext,skin health andaesthetictreatm entsplayacrucialrolein preventingproblem s. Theappearanceoftheskinref lectsnotonlyhow welook,butalsohow weageinternaly.Skin changes,such aslos ofelasticity and pigmentation,can indicate deeperproces essuch as inf lam m ationoroxidativestres . Skincare is es ential;however,conventionaltreatments cannotaddres al complex is ues. Modern aesthetic medicine oferssolutionsthatalign with the conceptoflongevity.Today, anti-agingapproachesem phasizeprecision andm oderation,ratherthan exces .Patientsseek treatm entsthatim proveskinqualityw ithoutalteringtheirfacialfeatures. One signif icanttrend isbiostim ulation,which activatesskin regeneration proces es,such as colagenproduction.Technologiessuchasradiofrequency,ultrasound,andlasersimproveskin f irm nes and texture,providing naturalresults.These proceduresare suitable forindividuals whowishtoageharmoniouslyinthelongterm. Injectable treatments have also evolved. Neuromodulators are used strategicaly,preserving facialexpres ions w hile preventing deep w rinkles. Derm alf ilers,especialythosethatstim ulatethebiologyoftheskin,areused to supportstructure and improve tis ue quality,notmerely to add volume. Emphasis is placed on respecting anatomy, balance, and subtle rejuvenation— keyvaluesinmodernluxuryaesthetics. Regenerative medicine is also important in anti-aging care. Autologous treatm ents,such asplatelet-rich plasm a(PRP),use the patient’sow n biology. Although research continues,these methodsref lecta growing trend toward personalizedtreatmentsthathelprepairandregeneratetheskin. In today’s aesthetic m edicine, luxury m eans experience and treatm ent philosophy.Patientsseek a comprehensive and personalized approach that includesskincare,advanced procedures,healthy lifestyle recom m endations, andlong-term planning. Exces ive treatm ents or those dictated by fashion trends can damage tisues and ac elerate the aging proces .From asurgical perspective,aestheticsforlongevityrequires foresight. Every intervention must be evaluated notonly forits immediate efect butalsoforitslong-term impactontheskin. Ethicalpractice,proper patient counseling, and realistic expectations are es entialfor sustainable results. Anti-aging no longer means simply looking younger; it means maintaining the health and identity ofthe skin. Aesthetic treatments, when applied with discernment,integrate seamles ly into preventive medicine, contributing to increased confidence and a harmonious agingproces . True luxury in aesthetics lies in subtlety, science,and respect for naturalaging.As plasticsurgeons,we believe thatourrole is nottostoptime,buttoguidepatientstoward balancedandhealthyskinaging. Skincare doesnothave to be complicated orfolow trends.To preventaging and maintain healthy skin,itises entialto be consistent,protectthe skin,and respectitsbiology.Ultravioletradiation is the main cause ofskin aging.Even the mostadvanced treatmentscannotcompletely reverse the harmfulefectsofsunexposure.Applyingadequatesunprotectionises entialtopreservecolagen, DNA,andtheintegrityoftheskinbarier. M aintainingthehealthofthedermisiscrucialbecauseitpreventswaterlos ,reducesinf lammation, andsupportsskinregeneration.Productscontainingceram ides,cholesterol,fatyacids,glycerin,and hyaluronic acid help m aintain hydration.Exces ive exfoliation and aggres ive ingredients can damagetheskin. Retinoidsare highly efective in anti-aging proces esbecause they stimulate colagen production and improve skin texture and pigmentation.Itisimportant tochoosetherightformulaandfrequencyofuseac ordingtoyourskintype. Antioxidantsprotectthe skin againstpolution and ultravioletradiation.Vitam in C,niacinamide,and polyphenols contribute to increased skin brightnes and elasticity.Theseingredientsworkbestwhencombinedwithsunprotectionanda consistentskincare routine.In skincare,qualityism ore im portantthan quantity. High-qualityproductsinteractharmoniouslywiththebiologyoftheskin,helping reduceiritationandoferinglong-term benef its. Skincare is an es entialcom ponent of a healthy lifestyle.Factors such as adequate sleep,balanced nutrition,hormonalstabilty,and efective stres managementdirectlyinf luencetheskin agingproces .Noskincareproductcan replace these fundamentalelements.Therefore,the mostefective anti-aging strategies combine skincare with medicalrecommendations and a healthy lifestyle. In conclusion,the bestskincare is notthe mostaggres ive orthe most fashionable,butthe sm artestand m ostsustainable.Itises entialto protect the skin, maintain the integrity of its barier, and support its natural regenerative capacity in orderto preserve youthfuland healthy skin in the longterm. As a plastic surgeon,Ihave observed a shiftin how patients perceive aging.They no longerseek radical transformations or the complete halt of the aging proces ,butratherthe preservation ofquality,vitality, and individuality.Longevity is now as ociated with inteligent aging, supporting the body’s natural proces eswhilemaintainingharmonyandconf idence. SkinHealth,AestheticMedicine andLongevity
24% DISCOUNT 19% DISCOUNT 28% DISCOUNT NEW! Elixirw ith HyaluronicAcid,BIO AloeVeraandVitam inE, EQUILIBRIUM ,LifeCare® intensehydraƟonboost 21311 2-in-1DayandNightCream with BIO AloeVeraandHyaluronicAcid, EQUILIBRIUM ,LifeCare® com fortand24hhydraƟon 21312 2-in-1HandandBodyLoƟon withBIO AloeVeraandHyaluronic Acid,EQUILIBRIUM ,LifeCare® hydraƟonandcom fort forhandsandbody 100 ml M adeinItaly M adeinItaly M adeinItaly 100 ml £ 8.99 £ 11.99 100 ml £ 11.99 21313 57 BEAUTYANDPERSONALCARE
*productsparticipating intheEUROPEAN NATURAL BEAUTYAWARDS £ 14.49 9% DISCOUNT 27% DISCOUNT 200 ml M adeinItaly £ 23.59 200 ml M adeinItaly Sham poowithBIO aloe veraand oliveoil, EQUILIBRIUM ,LifeCare® de plynourishesthehair 21300 Repairm askforhairand scalp,w ith BIO aloevera and oliveoil,EQUILIBRIUM , LifeCare® intensive treatm entfor hairand scalp 21303 32% DISCOUNT M adeinItaly M oisturizingbodycream , w ith aloeveraand organic oilm ix,EQUILIBRIUM , LifeCare® m oisturizing,em olient andprotecƟveacƟon 21307 Showergelwith BIO aloeveraand lavender, EQUILIBRIUM ,LifeCare® gentlycaresfortheskin 21301 £ 19.49 250 ml M adeinItaly £ 12.69 200 ml 9% DISCOUNT 58 BEAUTYANDPERSONALCARE
£ 5.29 4.8 g M adeinGermany M adeinItaly £ 13.59 300 ml 15% DISCOUNT Lip balm w ith aloevera andsheabuƩer,SPF25, EQUILIBRIUM ,LifeCare® hydraƟon,protecƟon, and com pletecare 21309 LiquidsoapwithBIO aloe veraand hyaluronicacid, EQUILIBRIUM ,LifeCare® gentleand ef fecƟve cleansing 21310 M adeinItaly 100 ml £ 13.79 FAM ILYSunCareSun LoƟon,SPF30, EQUILIBRIUM ,LifeCare® UVA andUVBprotecƟon 21308 21% DISCOUNT Rol-ondeodorantwithBIO aloeveraand rosem ary, EQUILIBRIUM ,LifeCare® com plieswith skin physiology 21302 M adeinItaly £ 10.99 50 ml 59 BEAUTYANDPERSONALCARE
£ 11.49 150 ml M adeinItaly PrebioGlow M icelarW ater, LifeCare® 21287 £ 17.49 30 ml M adeinItaly DeepLiŌ HA Concentrated Serum w ith HyaluronicAcid,LifeCare® 21288 £ 19.29 22% DISCOUNT 23% DISCOUNT 25% DISCOUNT 30 ml M adeinItaly Botaniq LIFTSerum w ith PlantColagen,LifeCare® 21289 DERMATO COSMETIC 60 BEAUTYANDPERSONALCARE
£ 32.99 50 ml 50 ml M adeinEU BioƟs im a®Instant PerfecƟon with argan oiland eveningprim rose ensuresm ake-up resistance 21213 M adeinGermany £ 33.99 ULTRA HydraƟonCream , withSPF15andHyaluronic Acid,LifeCare® naturalingredients 21266 £ 21.69 50 ml M adeinGermany Brighteningfacecream foragespots,w ith Neurolightand Sepiw hite,LifeCare® BIO cerƟf ied -fades age spots 21211 M adeinGermany £ 9.99 15capsules Capsules,w ith Hyaluron & Colagen Com plex,LifeCare® dietarysupplem entfor hairand nails 21199 61 BEAUTYANDPERSONALCARE
£ 42.99 25% DISCOUNT 50 ml £ 26.99 30 ml M adeinItaly PepƟLiŌ Cream withPepƟdes, PhytoreƟnol,Ceram idesand HyaluronicAcid,LifeCare® visiblef irm nes and intensive regeneraƟon 21290 M adeinEU AnƟ-wrinklem agneƟcm ask, M agneƟcM ask,LifeCare® innovaƟvetechnology 21219 NEW! 62 BEAUTYANDPERSONALCARE
30 ml £ 27.99 M adeinItaly Hairand skin oil,M agicElixir, w ith BIO plants,LifeCare® instantacƟon 21258 M adeinGermany 250 ml £ 24.99 M adeinGermany 30 ml £ 25.99 HairLos Sham poo,with Caf feineandBIO Herbs, LifeCare® strengthensthehairroot andpreventsdandruf f 21263 HairGrowthSerum ,with Caf feineandBIO Herbs, LifeCare® againsthairlos 21264 63 BEAUTYANDPERSONALCARE
£ 8.99 500 ml M adeinGermany Sham poo forgreasyhair, with BIO neƩle,LifeCare® oilyhair,toningef fect 403 £ 8.99 500 ml M adeinGermany AnƟ-dandruf f sham poo,with BIO plantsextract,LifeCare® anƟ-dandruf f 404 £ 8.99 500 ml M adeinGermany Sham pooforvolum e, withBIO cham om ile, LifeCare® volum eandshine 409 64 BEAUTYANDPERSONALCARE
4106 Sham pooPHYTELENE COM PLEX,w ith garlicand BIO plants,LifeCare® regeneraƟon M adeinGermany £ 13.49 500 ml M adeinGermany Hairm ask,w ith BIO olive oil,Life Care® nourishesand regeneratesthehair 457 £ 12.69 300 ml M adeinGermany ForƟfyingsham poo, w ith BIO rosem ary, LifeCare® strengthensthehair 4103 £ 10.99 500 ml M adeinGermany HaircondiƟoner,with BIO plants,LifeCare® intenselynourishes the hair 424 £ 11.29 500 ml 65 BEAUTYANDPERSONALCARE
M adeinGermany 500 ml £ 8.99 M adeinGermany 500 ml £ 8.99 M adeinGermany 500 ml £ 8.99 Showergel,with BIO Eucalyptus,LifeCare® energizing 4011 Showergel,withPineand BIO Herbs,LifeCare® refreshing 4012 Showergel,with BIO Lem on balm ,LifeCare® calming 4013 66 BEAUTYANDPERSONALCARE
Bodycream ,with Shea buƩerandBIO plants, LifeCare® protectsand soothes 4320 M adeinGermany £ 9.49 250 ml THERMAL HEATING EFFECT visibly reduces the orange peel appearance of the skin! M adeinGermany £ 9.49 250 ml M adeinGermany 250 ml £ 17.99 IntensiveCareCream with OrganicSeaBuckthorn and Herbs,LifeCare® intensive skin care 4504 AnƟ-CeluliteGel,with BIO m int,LifeCare® therm alef fect 4040 M adeinGermany Scrub w ith Hyaluronic AcidandHem pOil, LifeCare® forfaceandbody 4620 £ 13.49 250 ml 67 BEAUTYANDPERSONALCARE
M adeinGermany 200 ml £ 9.49 Facecream ,w ith BIO cham om ile,LifeCare® nourishesandsoothes the skin 4571 Gel,w ith Snail extract,Life Care® recoveryand beauty 4046 M adeinGermany £ 19.49 100 ml M adeinGermany 200 ml £ 10.29 Cream ,with BIO grape seed oiland calendula, LifeCare® hydraƟon and regeneraƟon 4546 M adeinGermany £ 15.99 100 g SheaBuƩer, natural,LifeCare® sƟm ulatesƟs ue regeneraƟon 4019 68 BEAUTYANDPERSONALCARE
M adeinGermany InƟm atewash gel,w ith cham om ileandBIO plants,LifeCare® pH specif ictotheinƟm atearea 4541 £ 10.99 500 ml LIQUID SOAP SHOWER GEL BUBBLE BATH TRIPLE EFECT Liquid soap,with BIO cham om ile and calendula,LifeCare® soothingand regeneraƟng 4000 3in 1Liquid soap,with lavender and BIO herbs,LifeCare® relaxesthesenses 4104 M adeinGermany £ 7.19 500 ml M adeinGermany £ 7.99 500 ml 69 BEAUTYANDPERSONALCARE
Does not contain aluminum particles and artificial colorants! Without Aluminum M adeinGermany Deorol-on,withBIO cham om ileand rosem ary,LifeCare® soothesiritated skin 4544 £ 8.29 50 ml Hand cream ,with BIO grape seedsand alm ond oil,LifeCare® intensively m oisturizes 4545 M adeinGermany £ 7.99 100 ml M adeinGermany £ 8.99 250 ml Soothinggelforiritated skin,w ith BIO m int,LifeCare® invigoratesand relaxesthe skin 4412 70 BEAUTYANDPERSONALCARE
30% DISCOUNT NEW! M adeinGermany £ 4.75 100 ml GeltoothpastewithBIO plants,LifeCare® naturalcare,healthysm ile 4680 M adeinGermany £ 8.99 100 ml Shavinggel,M ann, w ith BIO calendula, LifeCare® reducesiriƟaƟon 4456 M adeinItaly £ 6.99 125 ml AloeVeraGel,LifeCare® instanthydraƟonand soothingef fect 4709 M adeinGermany £ 6.49 100 ml W hiteningtoothpaste, w ith acƟvated charcoal, LifeCare® restoresthenatural whitenes ofte th 4085 71 BEAUTYANDPERSONALCARE
Does not contain aluminum derivatives and artificial dyes. ALUMINIUM FRE M adeinGermany Kräuter®M ann AŌershave balm with BIO calendula rem edyforiritated skin 4455 £ 8.99 100 ml M adeinGermany Deorol-onM ann,with BIO calendula,LifeCare® protectssensiƟve skin 4457 £ 8.29 50 ml M adeinGermany Sham pooand showergel,Baby, with aloeveraand BIO plants,LifeCare® 4047 £ 14.99 200 ml 72 BEAUTYANDPERSONALCARE
Discovertheproductsinthe HOME CARE range 73 HOME CARE
IMPROVED FORMULA WITH ORANGE ESSENTIAL OIL. 500 ml Bathroom caresoluƟon withes enƟalpepperm int oil,LifeCare® rem oveslim escale deposits 975 £ 11.69 M adeinGermany 500 ml ECODETERGENT www.ecocert.com M adeinGermany UniversalDetergent with es enƟalorange oil,LifeCare® orangees enƟaloil formula 920 £ 9.99 AcƟveGel,with es enƟal pepperm intoilforcleaning thetoilet,LifeCare® scalesand providesshine 508 £ 11.49 M adeinGermany 750 ml ECODETERGENT www.ecocert.com W indow cleaner, LifeCare® anƟstaƟcef fect 980 £ 11.29 M adeinGermany 500 ml PACKAGE 100% RECYCLED PACKAGE 100% RECYCLED PACKAGE 100% RECYCLED 74 HOME CARE
LaundryCondiƟonerwith es enƟalavenderoil,LifeCare® protectsthef ibersfrom wear 915 £ 13.99 M adeinGermany 1 L LaundryBleach,LifeCare® rem ovesdif f i cultstains £ 14.99 500 g M adeinGermany ECODETERGENT www.ecocert.com ECODETERGENT www.ecocert.com 905 UniversalLiquid Detergent,w ith lavenderes enƟaloil,LifeCare® £ 18.49 19% DISCOUNT 1.5 l M adeinGermany 9754 75 HOME CARE
ECODETERGENT www.ecocert.com PACKAGE 100% RECYCLED £ 12.49 500 ml M adeinGermany Oven cleaning soluƟon,LifeCare® degreasingacƟon £ 9.49 500 ml M adeinGermany £ 9.49 500 ml M adeinGermany 917 BIO Dishwashingliquid,with es enƟalorangeoil,LifeCare® concentrated and ef f i cient 937 BIO Dishwashingliquid,with es enƟalem ongras oil,LifeCare® concentrated and ef f i cient 935 76 HOME CARE
Discovertheproductsinthe NUTRITION AND SPORTS range 77 NUTRITION AND SPORTS
ECO Barw ith cereals,m aple syrup,and dates,LifeCare® opƟm alf iberintake 9257 £ 1.69 M adeinEU 25 g Sm oothieVegan Protein,LifeCare® energizer 1307 £ 15.29 M adeinGermany 150 g Sm oothieVegan Detox,LifeCare® detoxif ier 1306 £ 15.29 M adeinGermany 150 g AT-BIO-301 Unref inedOrganic Brow n Sugar,LifeCare® 100% natural FabricatînRom ânia 100 g £ 1.15 1312 78 NUTRITION AND SPORTS
Family umbrela, LifeCare® 120 cm £ 19.39 226 Carnum berfram e,LifeCare® £ 4.29 421 Biodegradablepen, LifeCare® £ 1.09 229 Pen,LifeCare® £ 1.39 235 79
STARTYOUR BUSINES WITH US Buildyourfuturewith DirectSalesAcademy! W hatwil you learn atthe DirectSalesAcadem y? Suc es in direct sales is no longer just a dream— it’s a realand ac es ible goalthanksto the DirectSalesAcademy –an educational solution developed with a strategicinternationalpartner,designed to supportentrepreneursintheworldofdirectseling. Through a unique educational partnership, we ofer high-quality m aterials created by internationalexperts,enhanced w ith artif icial inteligence. The content is available in English, with subtitles in Romanian,Hungarian,Italian,German,French,Spanish,Rus ian,and Serbian. Rapidgrow thstrategiesindirectsales Moderntechniquesfornetworkingandleadership Methodsforbuildingasuc es fulteam Negotiationandpersuasionskils Digitaltoolsforefectivesales Eachcourseiscreatedbyinternationalexpertsw ithyearsofexperience in the f ield and isdesigned to provide practicalsolutionsthatyou can applyimmediately. Everyles onincludesashortvideopresentedbyyourAItrainer,course materials,exercises,and chalenges to help you implement what you’velearned. W hetheryou’re juststarting outorlooking to take your busines to the nextlevel,the DirectSalesAcadem y gives you ac es to: 80
RkJQdWJsaXNoZXIy MzQ3NDYwNg==